STT3A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18157625UL

Catalog No. NB433812

Description

STT3A Polyclonal specifically detects STT3A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: STT3A
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: Integral membrane protein 1EC 2.4.1.119, integral transmembrane protein 1, ITM1dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A, MGC9042, Oligosaccharyl transferase subunit STT3A, STT3, subunit of the oligosaccharyltransferase complex, homolog A (S.cerevisiae), STT3-AFLJ27038, TMCB5, transmembrane conserved, Transmembrane protein TMC
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: STT3A
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:VRIGGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKR
• Quantity: 25 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 3703
• Target Species: Human
• Isotype: IgG

For Research Use Only