Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SUCLG1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP238318
Description
SUCLG1 Polyclonal specifically detects SUCLG1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
SUCLG1 | |
Polyclonal | |
Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
P53597 | |
SUCLG1 | |
This antibody was developed against a recombinant protein corresponding to amino acids: ASVIYVPPPFAAAAINEAIEAEIPLVVCITEGIPQQDMVRVKHKLLRQEKTRLIGPNCPGVINPGECKIGIM | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
EC 6.2.1, EC 6.2.1.4, FLJ21114, FLJ43513, GALPHA, MTDPS9, SCS-alpha, succinate-CoA ligase, alpha subunit, succinate-CoA ligase, GDP-forming, alpha subunit, succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial, Succinyl-CoA synthetase subunit alpha, SUCLA1 | |
Rabbit | |
Affinity Purified | |
RUO | |
8802 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction