Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SUCLG1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
$405.00 - $670.00
Specifications
| Antigen | SUCLG1 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SUCLG1 Polyclonal specifically detects SUCLG1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| SUCLG1 | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse, Rat | |
| EC 6.2.1, EC 6.2.1.4, FLJ21114, FLJ43513, GALPHA, MTDPS9, SCS-alpha, succinate-CoA ligase, alpha subunit, succinate-CoA ligase, GDP-forming, alpha subunit, succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial, Succinyl-CoA synthetase subunit alpha, SUCLA1 | |
| SUCLG1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 8802 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LPQNGIRHCSYTASRQHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGQTHLGLPVFNTVKEAKEQTGA | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title