SUCLG2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24761025UL

Catalog No. NB396144

Description

SUCLG2 Polyclonal specifically detects SUCLG2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SUCLG2
• Classification: Polyclonal
• Dilution: Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:5000 - 1:10000, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:5000 - 1:10000
• Gene Alias: EC 6.2.1, EC 6.2.1.4, GBETA, GTP-specific succinyl-CoA synthetase subunit beta, mitochondrial, succinate-CoA ligase, GDP-forming, beta subunit, succinyl-CoA ligase, GDP-forming, beta chain, mitochondrial, succinyl-CoA synthetase, beta-G chain
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SUCLG2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: FGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVQEAQKILNNSGLPITSAIDLEDAAKKAVASVAKK
• Quantity: 25 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 8801
• Target Species: Human
• Isotype: IgG

For Research Use Only