Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SUGT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP238518
Description
SUGT1 Polyclonal specifically detects SUGT1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
SUGT1 | |
Polyclonal | |
Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Q9Y2Z0 | |
SUGT1 | |
This antibody was developed against a recombinant protein corresponding to amino acids: EEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWK | |
0.1 mL | |
Cell Cycle and Replication | |
10910 | |
Human | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
Protein 40-6-3, putative 40-6-3 protein, Sgt1, SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae), SGT1B protein, suppressor of G2 allele of SKP1 homolog, suppressor of G2 allele of SKP1, S. cerevisiae, homolog of | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction