Sulfatase 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP231584

Catalog No. NBP231584

Description

Sulfatase 1 Polyclonal specifically detects Sulfatase 1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Sulfatase 1
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q8IWU6
• Gene Symbols: SULF1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QPRNIAKRHDEGHKGPRDLQASSGGNRGRMLADSSNAVGPPTTVRVTHKCFILPNDSIHCERELYQSARAWKDHKAYIDKEIEALQD
• Quantity: 0.1 mL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 23213
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 3.1.6, EC 3.1.6.-, EC 3.1.6.14, extracellular sulfatase Sulf-1, FLJ30905, FLJ38022, FLJ41750, hSulf-1, KIAA1077sulfatase FP, SULF-1, sulfatase 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only