Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SUMO-interacting Motif (SIM) Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$377.03 - $666.47
Specifications
| Antigen | SUMO-interacting Motif (SIM) |
|---|---|
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SUMO-interacting Motif (SIM) Polyclonal specifically detects SUMO-interacting Motif (SIM) in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| SUMO-interacting Motif (SIM) | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Chromosome 5 Open Reading Frame 25, Oocyte Maturation Associated 1, OOMA1, Platform Element For Inhibition Of Autolytic Degradation, PLEIAD, SIMC1, SUMO-Interacting Motif-Containing Protein 1, SUMO-Interacting Motifs Containing 1 | |
| SIMC1 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 375484 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YVIDLTRAEGENRPIATLDLTLEPVTPSQREPTSLQTCASLSGKAVMEGQVDRSSQPTARRLINSDPVDLDLVEE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title