Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ SUR1 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA578696
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA578696 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA578696 Supplier Invitrogen™ Supplier No. PA578696
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human placenta tissue, rat brain tissue, mouse brain tissue. Flow: A431 cell.

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies. This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion. Alternative splicing of this gene has been observed; however, the transcript variants have not been fully described.
TRUSTED_SUSTAINABILITY

Specifications

Antigen SUR1
Applications Flow Cytometry, Immunohistochemistry (Frozen), Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene ABCC8
Gene Accession No. Q09428, Q09429
Gene Alias ABC36; ABCC8; AM60008PU-N; ATP binding cassette subfamily C member 8; ATP-binding cassette sub-family C member 8; ATP-binding cassette transporter sub-family C member 8; ATP-binding cassette, subfamily C (CFTR/MRP), member 8; ATP-binding cassette, sub-family C (CFTR/MRP), member 8; D930031B21Rik; HHF1; HI; HRINS; LOW QUALITY PROTEIN: ATP-binding cassette sub-family C member 8; MRP8; PH SUR1; PHHI; sulfonylurea receptor; sulfonylurea receptor (hyperinsulinemia); sulfonylurea receptor 1; sulfonylurea receptor subunit 1; sulphonylurea receptor 1; SUR; SUR1; SUR1 protein; SUR1delta2; TNDM2
Gene Symbols ABCC8
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human SUR1 (TIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVTERKA).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 20927, 25559, 6833
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.