Invitrogen™ SUR1 Polyclonal Antibody, DyLight™ 488

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA578697

Catalog No. PIPA578697

Description

Positive Control - Flow: A431 cell.

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies. This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion. Alternative splicing of this gene has been observed; however, the transcript variants have not been fully described.

Specifications

• Antigen: SUR1
• Classification: Polyclonal
• Conjugate: DyLight 488
• Gene: ABCC8
• Gene Alias: ABC36; ABCC8; AM60008PU-N; ATP binding cassette subfamily C member 8; ATP-binding cassette sub-family C member 8; ATP-binding cassette transporter sub-family C member 8; ATP-binding cassette, subfamily C (CFTR/MRP), member 8; ATP-binding cassette, sub-family C (CFTR/MRP), member 8; D930031B21Rik; HHF1; HI; HRINS; LOW QUALITY PROTEIN: ATP-binding cassette sub-family C member 8; MRP8; PH SUR1; PHHI; sulfonylurea receptor; sulfonylurea receptor (hyperinsulinemia); sulfonylurea receptor 1; sulfonylurea receptor subunit 1; sulphonylurea receptor 1; SUR; SUR1; SUR1 protein; SUR1delta2; TNDM2
• Host Species: Rabbit
• Purification Method: Antigen Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 6833
• Content And Storage: 4°C, store in dark, DO NOT FREEZE!
• Form: Liquid

• Applications: Flow Cytometry
• Concentration: 0.5 mg/mL
• Formulation: PBS with 50% glycerol and 0.02% sodium azide
• Gene Accession No.: Q09428
• Gene Symbols: ABCC8
• Immunogen: A synthetic peptide corresponding to a sequence of human SUR1 (TIQREGTLKDFQ RSECQLFEHWKTLMNRQDQELEKETVTERKA).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG