Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SUSD4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | SUSD4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159975
|
Novus Biologicals
NBP159975 |
100 μL |
Each for $487.50
|
|
|||||
|
NBP15997520
|
Novus Biologicals
NBP15997520UL |
20 μL | N/A | N/A | N/A | ||||
Description
SUSD4 Polyclonal specifically detects SUSD4 in Human samples. It is validated for Western Blot.Specifications
| SUSD4 | |
| Polyclonal | |
| Rabbit | |
| Q5VX71 | |
| 55061 | |
| Synthetic peptides corresponding to SUSD4(sushi domain containing 4) The peptide sequence was selected from the middle region of SUSD4. Peptide sequence HGDFVCHPRPCERYNHGTVVEFYCDPGYSLTSDYKYITCQYGEWFPSYQV. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ10052, PRO222, sushi domain containing 4, sushi domain-containing protein 4, YHGM196 | |
| SUSD4 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title