Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SUSD4 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen SUSD4
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB125249
View Documents
Novus Biologicals
NBP310174100UL
100 μg
Each for $352.89
Add to cart
 
NB125250
View Documents
Novus Biologicals
NBP31017425UL
25 μg
Each for $106.19
Add to cart
 
Description

Description

SUSD4 Polyclonal antibody specifically detects SUSD4 in Mouse samples. It is validated for Western Blot
Specifications

Specifications

SUSD4
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
55061
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Mouse
FLJ10052, PRO222, sushi domain containing 4, sushi domain-containing protein 4, YHGM196
The immunogen is a synthetic peptide directed towards the middle region of mouse SUSD4 (NP_659045.2). Peptide sequence LVLLLVILARMFQTKFKAHFPPRGPPRSSSSDPDFVVVDGVPVMLPTYDE
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit