SUV420h1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257721

Catalog No. NBP257721

Description

SUV420h1 Polyclonal specifically detects SUV420h1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: SUV420h1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: C630029K18Rik, CGI85, CGI-85, EC 2.1.1.43, histone-lysine N-methyltransferase SUV420H1, KMT5B, KMT5B Lysine N-methyltransferase 5B, MGC118906, MGC118909, MGC21161, MGC703, Su(var)4-20 homolog 1, Suppressor of variegation 4-20 homolog 1, suppressor of variegation 4-20 homolog 1 (Drosophila), suv4-20h1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: KMT5B
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DQGEHSGTVGVPVSYTDCAPSPVGCSVVTSDSFKTKDSFRTAKSKKKRRITRYDAQLILENNSGIPKLTLR
• Quantity: 100 μL
• Research Discipline: Cancer, Epigenetics, Transcription Factors and Regulators
• Gene ID (Entrez): 51111
• Target Species: Human
• Isotype: IgG

For Research Use Only