Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SUV420h1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $610.00

Specifications

Antigen	SUV420h1
Applications	Immunocytochemistry, Immunofluorescence
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP257721 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP257721	100 μL	Each for $610.00	Only null left	Sign In or Register to check your price. Add to Cart

NB435358 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP25772125UL	25 μL	Each for $382.00	Only null left	Sign In or Register to check your price. Add to Cart

Description

SUV420h1 Polyclonal specifically detects SUV420h1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen	SUV420h1
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Cancer, Epigenetics, Transcription Factors and Regulators
Gene Alias	C630029K18Rik, CGI85, CGI-85, EC 2.1.1.43, histone-lysine N-methyltransferase SUV420H1, KMT5B, KMT5B Lysine N-methyltransferase 5B, MGC118906, MGC118909, MGC21161, MGC703, Su(var)4-20 homolog 1, Suppressor of variegation 4-20 homolog 1, suppressor of variegation 4-20 homolog 1 (Drosophila), suv4-20h1
Gene Symbols	KMT5B
Isotype	IgG
Purification Method	Affinity Purified

Applications	Immunocytochemistry, Immunofluorescence
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human
Gene ID (Entrez)	51111
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DQGEHSGTVGVPVSYTDCAPSPVGCSVVTSDSFKTKDSFRTAKSKKKRRITRYDAQLILENNSGIPKLTLR
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

SUV420h1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents