Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SUV420h1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP178303
Description
SUV420h1 Polyclonal specifically detects SUV420h1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
SUV420h1 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
C630029K18Rik, CGI85, CGI-85, EC 2.1.1.43, histone-lysine N-methyltransferase SUV420H1, KMT5B, KMT5B Lysine N-methyltransferase 5B, MGC118906, MGC118909, MGC21161, MGC703, Su(var)4-20 homolog 1, Suppressor of variegation 4-20 homolog 1, suppressor of variegation 4-20 homolog 1 (Drosophila), suv4-20h1 | |
Rabbit | |
99 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4.0-8.0 ug/ml | |
Q4FZB7 | |
KMT5B | |
Synthetic peptide directed towards the middle region of human SUV420H1. Peptide Sequence NNGFNSGSGSSSTKLKIQLKRDEENRGSYTEGLHENGVCCSDPLSLLESR. | |
Affinity purified | |
RUO | |
51111 | |
Human, Mouse, Rat, Canine, Equine, Guinea Pig | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction