Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Synaptic glycoprotein SC2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | Synaptic glycoprotein SC2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP16008820
|
Novus Biologicals
NBP16008820UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP160088
|
Novus Biologicals
NBP160088 |
100 μL |
Each for $487.50
|
|
|||||
Description
Synaptic glycoprotein SC2 Polyclonal specifically detects Synaptic glycoprotein SC2 in Human samples. It is validated for Western Blot.Specifications
| Synaptic glycoprotein SC2 | |
| Polyclonal | |
| Rabbit | |
| Q9NZ01 | |
| 9524 | |
| Synthetic peptides corresponding to GPSN2(glycoprotein, synaptic 2) The peptide sequence was selected from the middle region of GPSN2. Peptide sequence PFIYGHKYDFTSSRHTVVHLACICHSFHYIKRLLETLFVHRFSHGTMPLR. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 1.3.1, EC 1.3.1.38, glycoprotein, synaptic 2, GPSN2, Synaptic glycoprotein SC2, TERSC2, trans-2,3-enoyl-CoA reductase | |
| TECR | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title