Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Syndecan-2/CD362 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP325170

Catalog No. NB301282


Only null left
Add to Cart

Description

Description

Syndecan-2/CD362 Polyclonal antibody specifically detects Syndecan-2/CD362 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Specifications

Specifications

Syndecan-2/CD362
Polyclonal
Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
CD362 antigen, fibroglycan, heparan sulfate proteoglycan 1, cell surface-associated, Heparan sulfate proteoglycan core protein, HSPG, HSPG1syndecan proteoglycan 2, SYND2cell surface-associated heparan sulfate proteoglycan 1, syndecan 2, syndecan-2
This antibody has been engineered to specifically recognize the recombinant protein Syndecan-2/CD362 using the following amino acid sequence: KVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVL
100 μL
Extracellular Matrix
6383
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
IgG
Immunocytochemistry
Unconjugated
PBS, pH 7.2, 40% glycerol
Rabbit
Affinity purified
RUO
Primary
Human
Purified
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.