Syndecan-2/CD362 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP325170

Catalog No. NB301282

Description

Syndecan-2/CD362 Polyclonal antibody specifically detects Syndecan-2/CD362 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: Syndecan-2/CD362
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: CD362 antigen, fibroglycan, heparan sulfate proteoglycan 1, cell surface-associated, Heparan sulfate proteoglycan core protein, HSPG, HSPG1syndecan proteoglycan 2, SYND2cell surface-associated heparan sulfate proteoglycan 1, syndecan 2, syndecan-2
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein Syndecan-2/CD362 using the following amino acid sequence: KVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVL
• Quantity: 100 μL
• Research Discipline: Extracellular Matrix
• Gene ID (Entrez): 6383
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunocytochemistry
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified