Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SYT11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | SYT11 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SYT11 Polyclonal specifically detects SYT11 in Human samples. It is validated for Western Blot.Specifications
| SYT11 | |
| Polyclonal | |
| Rabbit | |
| Neuronal Cell Markers, Neurotransmission | |
| DKFZp781D015, KIAA0080synaptotagmin 12, MGC10881, MGC17226, synaptotagmin XISYT12, synaptotagmin-11, SytXI | |
| SYT11 | |
| IgG | |
| 48 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9BT88 | |
| 23208 | |
| Synthetic peptides corresponding to SYT11 (synaptotagmin XI) The peptide sequence was selected from the N terminal of SYT11. Peptide sequence AGLLSRDKDPRGPSSGSCIDQLPIKMDYGEELRSPITSLTPGESKTTSPS. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
SYT11 Antibody, Novus Biologicals™