Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SYT11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | SYT11 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SYT11 Polyclonal specifically detects SYT11 in Human samples. It is validated for Western Blot.Specifications
SYT11 | |
Polyclonal | |
Rabbit | |
Neuronal Cell Markers, Neurotransmission | |
DKFZp781D015, KIAA0080synaptotagmin 12, MGC10881, MGC17226, synaptotagmin XISYT12, synaptotagmin-11, SytXI | |
SYT11 | |
IgG | |
48 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q9BT88 | |
23208 | |
Synthetic peptides corresponding to SYT11 (synaptotagmin XI) The peptide sequence was selected from the N terminal of SYT11. Peptide sequence PPYKFIHMLKGISIYPETLSNKKKIIKVRRDKDGPGREGGRRNLLVDAAE. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title