Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SYT16 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SYT16 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SYT16 Polyclonal specifically detects SYT16 in Human samples. It is validated for Western Blot.Specifications
SYT16 | |
Polyclonal | |
Rabbit | |
Q17RD7 | |
83851 | |
Synthetic peptides corresponding to SYT16 (synaptotagmin XVI) The peptide sequence was selected from the N terminal of SYT16. Peptide sequence DKLDQDLDNIQIQETYFEDEEQDNDWSQEDANSLFLEVDHFSCCNSDLQD. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
chr14 synaptotagmin, CHR14SYT, STREP14, Synaptotagmin 14-like protein, synaptotagmin XIV-like, Synaptotagmin XIV-related protein, synaptotagmin XVI, synaptotagmin-16, SYT14L, SYT14R, yt14r | |
SYT16 | |
IgG | |
72 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title