Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SZRD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | SZRD1 |
---|---|
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Regulatory Status | RUO |
Description
SZRD1 Polyclonal specifically detects SZRD1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
SZRD1 | |
Unconjugated | |
RUO | |
26099 | |
Synthetic peptides corresponding to C1orf144 (chromosome 1 open reading frame 144) The peptide sequence was selected from the N terminal of C1orf144)(50ug). Peptide sequence MRRSLRAGKRRQTAGRKSKSPPKVPIVIQDDSLPAGPPPQIRILKRPTSN. | |
Primary |
Polyclonal | |
Rabbit | |
C1orf144, chromosome 1 open reading frame 144, DKFZp566C0424, MGC70432, PM21, putative MAPK activating protein PM20, Putative MAPK-activating protein PM18/PM20/PM22 | |
SZRD1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title