Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SZRD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | SZRD1 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157737
|
Novus Biologicals
NBP157737 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
SZRD1 Polyclonal specifically detects SZRD1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| SZRD1 | |
| Unconjugated | |
| RUO | |
| C1orf144, chromosome 1 open reading frame 144, DKFZp566C0424, MGC70432, PM21, putative MAPK activating protein PM20, Putative MAPK-activating protein PM18/PM20/PM22 | |
| SZRD1 | |
| IgG | |
| Affinity Purified |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 26099 | |
| Synthetic peptides corresponding to C1orf144 (chromosome 1 open reading frame 144) The peptide sequence was selected from the N terminal of C1orf144)(50ug). Peptide sequence MRRSLRAGKRRQTAGRKSKSPPKVPIVIQDDSLPAGPPPQIRILKRPTSN. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title