Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TAAR5 Antibody, Novus Biologicals™

TAAR5 Antibody, Novus Biologicals™
SDP

Catalog No. NBP16913220 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16913220 20 μL
NBP169132 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP16913220 Supplier Novus Biologicals Supplier No. NBP16913220UL

Description

Rabbit Polyclonal Antibody

TAAR5 Polyclonal specifically detects TAAR5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence.

Specifications

Antigen TAAR5
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:10-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias MGC138414, MGC138416, PNRRP11-295F4.5, Putative neurotransmitter receptor, taR-5, trace amine associated receptor 5, Trace amine receptor 5, trace amine-associated receptor 5
Gene Symbols TAAR5
Host Species Rabbit
Immunogen Synthetic peptides corresponding to TAAR5 (trace amine associated receptor 5) The peptide sequence was selected from the middle region of TAAR5. Peptide sequence GWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKSLAGAAKHERKA.
Molecular Weight of Antigen 38 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline GPCR, Vision
Primary or Secondary Primary
Gene ID (Entrez) 9038
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.