Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TAB2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25660725UL
Description
TAB2 Polyclonal specifically detects TAB2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
TAB2 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
FLJ21885, KIAA0733CHTD2, MAP3K7IP2mitogen-activated protein kinase kinase kinase 7 interacting protein 2, Mitogen-activated protein kinase kinase kinase 7-interacting protein 2, TAB-2, TAK1-binding protein 2, TGF-beta activated kinase 1/MAP3K7 binding protein 2, TGF-beta-activated kinase 1 and MAP3K7-binding protein 2, TGF-beta-activated kinase 1-binding protein 2 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
IgG |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
TAB2 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GSSQSSAHSQYNIQNISTGPRKNQIEIKLEPPQRNNSSKLRSSGPRTSSTSSSVNSQTLNRNQPTVY | |
25 μL | |
Cytokine Research, Signal Transduction | |
23118 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction