Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TAF148 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | TAF148 |
|---|---|
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TAF148 Polyclonal specifically detects TAF148 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| TAF148 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| RAFI48, SL1MGC:17061, TAFI48TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kD, TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa, TATA box-binding protein-associated factor 1A, TATA box-binding protein-associated factor RNA polymerase I subunit A, TBP-associated factor 1A, Transcription factor SL1,48kD subunit | |
| TAF1A | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 9015 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: HQWQQAAEYMYSYFQTLEDSDSYKRQAAPEIIWKLGSEILFYHPKSNMESFNTFANRMKNIGVMNYLKISLQHALYLLHHGMLKDAKRNLSE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title