TAF148 Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP310430100UL

Catalog No. NB125761

Description

TAF148 Polyclonal specifically detects TAF148 in Rat samples. It is validated for Western Blot.

Specifications

• Antigen: TAF148
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: RAFI48, SL1MGC:17061, TAFI48TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kD, TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa, TATA box-binding protein-associated factor 1A, TATA box-binding protein-associated factor RNA polymerase I subunit A, TBP-associated factor 1A, Transcription factor SL1,48kD subunit
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat TAF148 (NP_001032281). Peptide sequence FAQTTSACLSFLQEALLKHQWCRAAEYMHSYLQTLEDSDTYRKQAAPEII
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Rat
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9015
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.