Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TAF148 Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | TAF148 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
TAF148 Polyclonal specifically detects TAF148 in Rat samples. It is validated for Western Blot.Specifications
| TAF148 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Rat | |
| RAFI48, SL1MGC:17061, TAFI48TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kD, TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa, TATA box-binding protein-associated factor 1A, TATA box-binding protein-associated factor RNA polymerase I subunit A, TBP-associated factor 1A, Transcription factor SL1,48kD subunit | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of Rat TAF148 (NP_001032281). Peptide sequence FAQTTSACLSFLQEALLKHQWCRAAEYMHSYLQTLEDSDTYRKQAAPEII | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 9015 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title