TAF1D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP231821

Catalog No. NBP231821

Description

TAF1D Polyclonal specifically detects TAF1D in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TAF1D
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q9H5J8
• Gene Symbols: TAF1D
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YQPTGRPRGRPEGRRNPIYSLIDKKKQFRSRGSGFPFLESENEKNAPWRKILTFEQAVARGFFNYIEKLKYEHHL
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: JOSD3RNA polymerase I-specific TBP-associated factor 41 kDa, Josephin domain containing 3, MGC5306, RAFI41, TAF(I)41, TAFI41, TATA box binding protein (TBP)-associated factor, RNA polymerase I, D, 41kDa, TATA box-binding protein-associated factor 1D, TATA box-binding protein-associated factor RNA polymerase I subunit D, TBP-associated factor 1D, Transcription initiation factor SL1/TIF-IB subunit D
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79101
• Target Species: Human
• Isotype: IgG

For Research Use Only