Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TAF1D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP231821
Description
TAF1D Polyclonal specifically detects TAF1D in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
TAF1D | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Q9H5J8 | |
TAF1D | |
This antibody was developed against a recombinant protein corresponding to amino acids: YQPTGRPRGRPEGRRNPIYSLIDKKKQFRSRGSGFPFLESENEKNAPWRKILTFEQAVARGFFNYIEKLKYEHHL | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
JOSD3RNA polymerase I-specific TBP-associated factor 41 kDa, Josephin domain containing 3, MGC5306, RAFI41, TAF(I)41, TAFI41, TATA box binding protein (TBP)-associated factor, RNA polymerase I, D, 41kDa, TATA box-binding protein-associated factor 1D, TATA box-binding protein-associated factor RNA polymerase I subunit D, TBP-associated factor 1D, Transcription initiation factor SL1/TIF-IB subunit D | |
Rabbit | |
Affinity Purified | |
RUO | |
79101 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction