Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TAF8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP23818925UL
Description
TAF8 Polyclonal specifically detects TAF8 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
TAF8 | |
Polyclonal | |
Western Blot 0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Q7Z7C8 | |
TAF8 | |
This antibody was developed against a recombinant protein corresponding to amino acids: RTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFP | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
45/50kDa, FLJ32821, II, Protein taube nuss, RNA polymerase II, 43 kD, TAF(II)43,43, TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa, TATA box binding protein (TBP)-associated factor, RNA polymerase II, A, taube nuss homolog (mouse), TBP-associated factor 43 kDa, TBP-associated factor 8, transcription initiation factor TFIID subunit 8 | |
Rabbit | |
Affinity Purified | |
RUO | |
129685 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction