TAFA4/FAM19A4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159651

Catalog No. NBP159651

Description

TAFA4/FAM19A4 Polyclonal specifically detects TAFA4/FAM19A4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TAFA4/FAM19A4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Chemokine-like protein TAFA-4, family with sequence similarity 19 (chemokine (C-C motif)-like), member A4, FLJ25161, TAFA4, TAFA-4
• Host Species: Rabbit
• Molecular Weight of Antigen: 36 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96LR4
• Gene Symbols: FAM19A4
• Immunogen: Synthetic peptides corresponding to FAM19A4 (family with sequence similarity 19 (chemokine (C-C motif)-like), member A4) The peptide sequence was selected from the middle region of FAM19A4)(50ug). Peptide sequence SSQHLRGHAGHHQIKQGTCEVVAVHRCCNKNRIEERSQTVKCSCFPGQVA The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 151647
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

For Research Use Only