Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TAFA4/FAM19A4 Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310582100UL
Description
TAFA4/FAM19A4 Polyclonal specifically detects TAFA4/FAM19A4 in Rat samples. It is validated for Western Blot.Specifications
TAFA4/FAM19A4 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
Chemokine-like protein TAFA-4, family with sequence similarity 19 (chemokine (C-C motif)-like), member A4, FLJ25161, TAFA4, TAFA-4 | |
The immunogen is a synthetic peptide directed towards the N-terminal region of Rat TAFA4/FAM19A4 (NP_001128172). Peptide sequence VIKQGTCEVVAVHRCCNKNRIEERSQTVKCSCFPGQVAGTTRAQPSCVEA | |
100 μg | |
Primary | |
Rat | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
151647 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction