Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TAK1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$330.00 - $547.00
Specifications
Antigen | TAK1 |
---|---|
Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
Applications | Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
TAK1 Polyclonal antibody specifically detects TAK1 in Human samples. It is validated for ImmunofluorescenceSpecifications
TAK1 | |
Immunofluorescence | |
Unconjugated | |
Rabbit | |
Apoptosis, Immunology, Innate Immunity, Phospho Specific, Protein Kinase, Signal Transduction, Wnt Signaling Pathway | |
PBS, pH 7.2, 40% glycerol | |
6885 | |
IgG | |
Affinity purified |
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
Human | |
EC 2.7.11, EC 2.7.11.25, MEKK7, mitogen-activated protein kinase kinase kinase 7, TAK1/MAP3K7, TAK1TGF1a, TGF-beta activated kinase 1, TGF-beta-activated kinase 1, Transforming growth factor-beta-activated kinase 1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: PTSEGKRMSADMSEIEARIAATTAYSKPKRGHRKTASFGNILDVPEIVISGNGQPRRRSIQDLTVTGTEPGQ | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title