Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TAL2 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen TAL2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP180224
SDP
View Documents
Novus Biologicals
NBP180224
100 μL
Each of 1 for $487.50
Only null left
Add to Cart
 
Description

Description

TAL2 Polyclonal specifically detects TAL2 in Mouse samples. It is validated for Western Blot.
Specifications

Specifications

TAL2
Polyclonal
Rabbit
NP_033343
6887
Synthetic peptide directed towards the middle region of human Tal2. Peptide sequence INFLVKVLGEQSLHQTGVAAQGNILGLFPPKTRLPDEDDRTLLNDYRVPS.
Primary
Western Blot
Unconjugated
RUO
bHLHa19, Class A basic helix-loop-helix protein 19, TAL-2, T-cell acute lymphocytic leukemia 2, T-cell acute lymphocytic leukemia protein 2
TAL2
IgG
12 kDa
Videos
SDS
Documents

Documents

Product Certifications
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.