TAP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25593425UL

Catalog No. NB435525

Description

TAP1 Polyclonal specifically detects TAP1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: TAP1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: ABC transporter, MHC 1, ABCB2FLJ41500, antigen peptide transporter 1, APT1, ATP-binding cassette sub-family B member 2, ATP-binding cassette, sub-family B (MDR/TAP), member 2, D6S114E, Peptide supply factor 1, Peptide transporter involved in antigen processing 1, Peptide transporter PSF1, Peptide transporter TAP1, PSF-1, PSF1ABC17, Really interesting new gene 4 protein, RING4FLJ26666, TAP1*0102N, TAP1N, transporter 1, ATP-binding cassette, sub-family B (MDR/TAP), transporter associated with antigen processing, transporter, ATP-binding cassette, major histocompatibility complex, 1, Y3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°CC long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: TAP1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEK
• Quantity: 25 μL
• Research Discipline: Cell Biology, Diabetes Research, Membrane Trafficking and Chaperones
• Gene ID (Entrez): 6890
• Target Species: Human
• Isotype: IgG

For Research Use Only