Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TAS2R13 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | TAS2R13 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
TAS2R13 Polyclonal specifically detects TAS2R13 in Human samples. It is validated for Western Blot.Specifications
| TAS2R13 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| GPCR | |
| PBS buffer, 2% sucrose | |
| 50838 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| T2R13TRB3Taste receptor family B member 3, taste receptor type 2 member 13, taste receptor, family B, member 3, taste receptor, type 2, member 13 | |
| The immunogen is a synthetic peptide directed towards the middle region of Human TAS2R13 (NP_076409). Peptide sequence HIKDWLDRYERNTTWNFSMSDFETFSVSVKFTMTMFSLTPFTVAFISFLL | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title