Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TAT Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | TAT |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17928620
|
Novus Biologicals
NBP17928620UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP179286
|
Novus Biologicals
NBP179286 |
100 μL |
Each for $487.50
|
|
|||||
Description
TAT Polyclonal specifically detects TAT in Rat samples. It is validated for Western Blot.Specifications
| TAT | |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 2.6.1.5, L-tyrosine:2-oxoglutarate aminotransferase, tyrosine aminotransferase, tyrosine aminotransferase, cytosolic | |
| TAT | |
| IgG |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Rabbit | |
| NP_036800 | |
| 6898 | |
| The immunogen for this antibody is Tat. Peptide sequence PGLQPVRPSGAMYLMVGIEMEHFPEFENDVEFTERLIAEQAVHCLPATCF. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title