TATA binding protein TBP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238610

Catalog No. NBP238610

Description

TATA binding protein TBP Polyclonal specifically detects TATA binding protein TBP in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TATA binding protein TBP
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: P20226
• Gene Symbols: TBP
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYPS
• Quantity: 0.1 mL
• Research Discipline: Transcription Factors and Regulators
• Gene ID (Entrez): 6908
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: GTF2D, GTF2D1, HDL4, MGC126054, MGC126055, SCA17, TATA box binding protein, TATA sequence-binding protein, TATA-binding factor, TATA-box binding protein N-terminal domain, TATA-box factor, TATA-box-binding protein, TF2D, TFIIDMGC117320, Transcription initiation factor TFIID TBP subunit
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.