Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TAZ/WWTR1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP185067 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP185067 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP185067 Supplier Novus Biologicals Supplier No. NBP185067
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody has been used in 4 publications

TAZ/WWTR1 Polyclonal specifically detects TAZ/WWTR1 in Human, Mouse samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen TAZ/WWTR1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Simple Western 1:30, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200, Knockdown Validated
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q9GZV5
Gene Alias FLJ27004, FLJ45718, TAZDKFZp586I1419, transcriptional co-activator with PDZ-binding motif, Transcriptional coactivator with PDZ-binding motif, WW domain containing transcription regulator 1, WW domain-containing transcription regulator protein 1
Gene Symbols WWTR1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSST
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Chromatin Research, Mesenchymal Stem Cell Markers, Signal Transduction, Stem Cell Markers, Transcription Factors and Regulators
Primary or Secondary Primary
Gene ID (Entrez) 25937
Test Specificity Specificity of human TAZ/WWTR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.