Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TBC1D13 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | TBC1D13 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15689720
![]() |
Novus Biologicals
NBP15689720UL |
20 μL |
Each for $206.00
|
|
|||||
NBP156897
![]() |
Novus Biologicals
NBP156897 |
100 μL |
Each for $487.50
|
|
|||||
Description
TBC1D13 Polyclonal specifically detects TBC1D13 in Human samples. It is validated for Western Blot.Specifications
TBC1D13 | |
Polyclonal | |
Rabbit | |
Q5T270 | |
54662 | |
Synthetic peptides corresponding to TBC1D13(TBC1 domain family, member 13) The peptide sequence was selected from the middle region of TBC1D13. Peptide sequence FLLLVCCAMLMLIREQLLEGDFTVNMRLLQDYPITDVCQILQKAKELQDS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ10743, TBC1 domain family member 13, TBC1 domain family, member 13 | |
TBC1D13 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title