Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TBC1D22B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP186752
Description
TBC1D22B Polyclonal specifically detects TBC1D22B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
TBC1D22B | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
C6orf197, chromosome 6 open reading frame 197, dJ744I24.2, DKFZp762J0110, FLJ20337, MGC125626, MGC125627, RP4-744I24.2, TBC1 domain family member 22B, TBC1 domain family, member 22B | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
TBC1D22B | |
This antibody was developed against Recombinant Protein corresponding to amino acids:LATAAQVLENHSKLRVKPERSQSTTSDVPANYKVIKSSSDAQLSRNSSDTCLRNPLHKQQSLPLR | |
0.1 mL | |
Signal Transduction | |
55633 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction