Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TBC1D4 Antibody, Novus Biologicals™
SDP

Catalog No. NB404629 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB404629 25 μL
NBP238880 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB404629 Supplier Novus Biologicals Supplier No. NBP23888025UL
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

TBC1D4 Polyclonal specifically detects TBC1D4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen TBC1D4
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. O60343
Gene Alias Akt substrate of 160 kDa, AS160Acrg embryonic lethality minimal region ortholog, DKFZp779C0666, KIAA0603TBC (Tre-2, BUB2, CDC16) domain-containing protein, TBC1 domain family member 4, TBC1 domain family, member 4
Gene Symbols TBC1D4
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: MEPPSCIQDEPFPHPLEPEPGVSAQPGPGKPSDKRFRLWYVGGSCLDHRTTLPMLPWLMAEIRRRSQKPE
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Diabetes Research, Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 9882
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.