Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TBPL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | TBPL2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
TBPL2 Polyclonal specifically detects TBPL2 in Mouse samples. It is validated for Western Blot.Specifications
TBPL2 | |
Polyclonal | |
Purified | |
RUO | |
TATA box-binding protein-like protein 2, TATA box binding protein like 2, TBP2, TRF3 | |
TBPL2 | |
IgG | |
Protein A purified |
Western Blot | |
Unconjugated | |
Rabbit | |
NP_951014 | |
387332 | |
Synthetic peptide directed towards the N terminal of mouse TRF3. Peptide sequence FHPHLGGVKKASTDFSSVDLSFLPDELTQENRDQTVTGNKLASEESCRTR. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title