Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TBRG1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | TBRG1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TBRG1 Polyclonal specifically detects TBRG1 in Human samples. It is validated for Western Blot.Specifications
| TBRG1 | |
| Polyclonal | |
| Rabbit | |
| NP_116200 | |
| 84897 | |
| Synthetic peptide directed towards the N terminal of human TBRG1The immunogen for this antibody is TBRG1. Peptide sequence KARMKKLPKKSQNEKYRLKYLRLRKAAKATVFENAAICDEIARLEEKFLK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ14621, FLJ90113, MGC129890, NIAMFLJ25020, Nuclear interactor of ARF and Mdm2, TB-5, transforming growth factor beta regulator 1 | |
| TBRG1 | |
| IgG | |
| 29 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title