Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TBRG1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | TBRG1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
TBRG1 Polyclonal specifically detects TBRG1 in Human samples. It is validated for Western Blot.Specifications
TBRG1 | |
Polyclonal | |
Rabbit | |
NP_116200 | |
84897 | |
Synthetic peptide directed towards the N terminal of human TBRG1The immunogen for this antibody is TBRG1. Peptide sequence KARMKKLPKKSQNEKYRLKYLRLRKAAKATVFENAAICDEIARLEEKFLK. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ14621, FLJ90113, MGC129890, NIAMFLJ25020, Nuclear interactor of ARF and Mdm2, TB-5, transforming growth factor beta regulator 1 | |
TBRG1 | |
IgG | |
29 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title