Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TCEAL5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25472325UL
Description
TCEAL5 Polyclonal specifically detects TCEAL5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
TCEAL5 | |
Polyclonal | |
Immunohistochemistry-Paraffin 1:200 - 1:500 | |
TCEA-like protein 5, transcription elongation factor A (SII)-like 5, transcription elongation factor A protein-like 5, Transcription elongation factor S-II protein-like 5 | |
Rabbit | |
Immunogen affinity purified | |
RUO | |
340543 | |
Human | |
IgG |
Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
TCEAL5 | |
This antibody was developed against a Recombinant Protein corresponding to amino acids:PKDSQEDLQERHLSSEEMMRECGDVSRAQEELRK | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction