Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TCERG1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | TCERG1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TCERG1 Polyclonal specifically detects TCERG1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| TCERG1 | |
| Polyclonal | |
| Rabbit | |
| Cellular Markers, Transcription Factors and Regulators | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 10915 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PAFPPVMVPPFRVPLPGMPIPLPGVAMMQIVSCPYVKTVATTKTGVLPGMAPPIVPMIHPQVAIAASPATLAGATAVSEWTEYKTADG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| CA150TATA box-binding protein-associated factor 2S, co-activator of 150 kDa, TAF2SMGC133200, TATA box binding protein (TBP)-associated factor, RNA polymerase II, S, 150kD, TATA box-binding protein-associated factor 2S, transcription elongation regulator 1, Transcription factor CA150, Urn1 | |
| TCERG1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title