Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TCF-3/E2A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP23861125UL
Description
TCF-3/E2A Polyclonal specifically detects TCF-3/E2A in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
TCF-3/E2A | |
Polyclonal | |
Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
P15923 | |
TCF3 | |
This antibody was developed against a recombinant protein corresponding to amino acids: RTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPS | |
25 μL | |
Transcription Factors and Regulators | |
6929 | |
Human | |
IgG |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
BHLHB21, bHLHb21TCF-3, Class B basic helix-loop-helix protein 21, E2A immunoglobulin enhancer-binding factor E12/E47, E2AKappa-E2-binding factor, Immunoglobulin enhancer-binding factor E12/E47, Immunoglobulin transcription factor 1, ITF1Transcription factor ITF-1, MGC129647, MGC129648, Transcription factor 3, transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47), transcription factor E2-alpha, VDIR, VDR interacting repressor | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction