Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TCF7/TCF1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | TCF7/TCF1 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
TCF7/TCF1 Polyclonal specifically detects TCF7/TCF1 in Mouse samples. It is validated for Western Blot.Specifications
TCF7/TCF1 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Signal Transduction, Wnt Signaling Pathway | |
PBS buffer, 2% sucrose | |
6932 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
Mouse | |
FLJ36364, MGC47735, T-cell factor 1, T-cell specific, TCF1, TCF-7, transcription factor 7 (T-cell specific, HMG-box) | |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse TCF7/TCF1 (NP_001300910.1). Peptide sequence QLYPGWSARDNYGKKKRRSREKHQESTTGGKRNAFGTYPEKAAAPAPFLP | |
Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title