TCIRG1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Supplier:  Novus Biologicals NBP189333

Catalog No. NBP189333

Description

TCIRG1 Polyclonal specifically detects TCIRG1 in Human, Mouse samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TCIRG1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: a3, Atp6i, ATP6N1Cspecific 116-kDa vacuolar proton pump subunit, ATP6V0A3T-cell immune response cDNA 7, OC-116, OC-116 kDa, OC-116kDa, OC116Vph1, OPTB1, Osteoclastic proton pump 116 kDa subunit, Stv1, T-cell immune regulator 1, T-cell immune response cDNA7 protein, T-cell, immune regulator 1, T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein a, T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein A3, T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein aisoform 3, T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3, TIRC7ATPase, H+ transporting, 116kD, vacuolar proton translocating ATPase 116 kDa subunit A, Vacuolar proton translocating ATPase 116 kDa subunit a isoform 3, V-ATPase 116 kDa isoform a3, V-ATPase 116-kDa, V-type proton ATPase 116 kDa subunit a, V-type proton ATPase 116 kDa subunit a isoform 3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10312
• Target Species: Human, Mouse
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: TCIRG1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:RPADRQEENKAGLLDLPDASVNGWSSDEEKAGGLDDEEEAELVPSEVLMHQAIHTI
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of human TCIRG1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only