TCL1B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24760825UL

Catalog No. NB435802

Description

TCL1B Polyclonal specifically detects TCL1B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TCL1B
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: Oncogene TCL1B, Oncogene TCL-1B, SYN-1, Syncytiotrophoblast-specific protein, T-cell leukemia/lymphoma 1B, T-cell leukemia/lymphoma protein 1B, T-cell lymphoma/leukemia 1B, TCL1, TCL1/MTCP1-like protein 1, TML1TCL1/ MTCP1-like 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: TCL1B
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: WQMAVHTRELLSSGQMPFSQLPAVWQLYPGRKYRAADSSFWEIADHGQIDSMEQLVLTYQPE
• Quantity: 25 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 9623
• Target Species: Human
• Isotype: IgG

For Research Use Only