Invitrogen™ TCP1 Monoclonal Antibody (2E7)

Catalog No.	Quantity
PIMA532998	100 μg

Catalog No. PIMA532998 Supplier Invitrogen™ Supplier No. MA532998

Description

Mouse Monoclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human MCF-7 whole cell, human COLO-320 whole cell, human HepG2 whole cell, human A431 whole cell, human HT1080 whole cell. IHC: human lung cancer tissue, human placenta tissue. ICC/IF: MCF7 cell. Flow: HepG2 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The T Complex Polypeptide 1 (TCP-1) is approximately 60 kDa protein constitutively expressed in almost all eukaryotic cells, and is upregulated during spermatogenesis. It is found in the cytosol as a subunit of a hetero-oligomeric chaperone that is known to be involved in the folding of actin and tubulin. The family of proteins termed chaperonins act to recognize and stabilize polypeptide intermediates during folding, assembly and disassembly, and share many characteristics with Heat Shock Protein 70 (HSP70) including high abundance, induction by environmental stress, and ATPase activity. The chaperonin family includes the mitochondrial HSP60, Escherichia coli GroEL, the plastid Rubisco-subunit binding protein, and the archaebacterial protein TF55. The TCP-1 sequence shows nearly 40% identity to TF55, but only minimal similarity to HSP60 and GroEL.

Specifications

• Antigen: TCP1
• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry, Western Blot
• Classification: Monoclonal
• Clone: 2E7
• Concentration: 500 μg/mL
• Conjugate: Unconjugated
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene: TCP1
• Gene Accession No.: P17987
• Gene Alias: 65 kDa antigen; AI528772; c-cpn; CCT; Cct1; Ccta; CCTalpha; CCT-alpha; chaperonin-containing T-complex alpha subunit TCP1; chaperonin-containing T-complex polypeptide alpha subunit; cytosolic chaperonin containing t-complex polypeptide 1; D6S230E; hypothetical protein; p63; tailless complex polypeptide 1; tailless complex polypeptide 1A; Tailless complex polypeptide 1B; t-complex 1; t-complex polypeptide 1; t-complex protein 1; T-complex protein 1 alpha subunit-like protein; T-complex protein 1 subunit alpha; T-complex protein 1 subunit alpha A; T-complex protein 1 subunit alpha B; T-complex protein 1, alpha subunit; Tcp1; Tcp-1; TCP-1-A; TCP-1-alpha; TCP-1-B; Tp63; TRic; Unknown (protein for MGC:133746); YD8142.13; YD8142B.04; YDR212W
• Gene Symbols: TCP1
• Host Species: Mouse
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TCP1 alpha (515-551aa KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS).
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6950
• Target Species: Human
• Content And Storage: -20°C
• Product Type: Antibody
• Form: Lyophilized
• Isotype: IgG1