Invitrogen™ TCP1 Polyclonal Antibody

Catalog No.	Quantity
PIPA580100	100 μg

Catalog No. PIPA580100 Supplier Invitrogen™ Supplier No. PA580100

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human A431 whole cell lysates, human Hela whole cell lysates, human 293T whole cell lysates, human MOLT4 whole cell lysates, human Jurkat whole cell lysates, human A549 whole cell lysates, human MCF-7 whole cell lysates, human U251 whole cell lysates, rat heart tissue lysates, rat ovary tissue lysates, rat brain tissue lysates, rat lung tissue lysates, mouse heart tissue lysates, mouse ovary tissue lysates, mouse brain tissue lysates, mouse lung tissue lysates. IHC: mouse testis tissue, rat testis tissue, human testis tissue, human ovary cancer tissue. ICC/IF: CACO-2 cell.

The T Complex Polypeptide 1 (TCP-1) is approximately 60 kDa protein constitutively expressed in almost all eukaryotic cells, and is upregulated during spermatogenesis. It is found in the cytosol as a subunit of a hetero-oligomeric chaperone that is known to be involved in the folding of actin and tubulin. The family of proteins termed chaperonins act to recognize and stabilize polypeptide intermediates during folding, assembly and disassembly, and share many characteristics with Heat Shock Protein 70 (HSP70) including high abundance, induction by environmental stress, and ATPase activity. The chaperonin family includes the mitochondrial HSP60, Escherichia coli GroEL, the plastid Rubisco-subunit binding protein, and the archaebacterial protein TF55. The TCP-1 sequence shows nearly 40% identity to TF55, but only minimal similarity to HSP60 and GroEL.

Specifications

• Antigen: TCP1
• Applications: Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Classification: Polyclonal
• Concentration: 500 μg/mL
• Conjugate: Unconjugated
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene: TCP1
• Gene Accession No.: P11983, P17987, P28480
• Gene Alias: 65 kDa antigen; AI528772; c-cpn; CCT; Cct1; Ccta; CCTalpha; CCT-alpha; chaperonin-containing T-complex alpha subunit TCP1; chaperonin-containing T-complex polypeptide alpha subunit; cytosolic chaperonin containing t-complex polypeptide 1; D6S230E; hypothetical protein; p63; tailless complex polypeptide 1; tailless complex polypeptide 1A; Tailless complex polypeptide 1B; t-complex 1; t-complex polypeptide 1; t-complex protein 1; T-complex protein 1 alpha subunit-like protein; T-complex protein 1 subunit alpha; T-complex protein 1 subunit alpha A; T-complex protein 1 subunit alpha B; T-complex protein 1, alpha subunit; Tcp1; Tcp-1; TCP-1-A; TCP-1-alpha; TCP-1-B; Tp63; TRic; Unknown (protein for MGC:133746); YD8142.13; YD8142B.04; YDR212W
• Gene Symbols: TCP1
• Host Species: Rabbit
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TCP1 (515-551aa KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS).
• Purification Method: Antigen affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 21454, 24818, 6950
• Target Species: Human, Mouse, Rat
• Content And Storage: -20°C
• Product Type: Antibody
• Form: Lyophilized
• Isotype: IgG